BioLabs

Tesamorelin 10 & 20mg

R 1,523.00

Peptide Name

Tesamorelin Acetate (Lyophilized Powder)

Chemical Name/Structure

  • Chemical Name: (trans-3-Hexenoyl)-human growth hormone-releasing factor (1-44) acetate

  • Molecular Formula: C_{221H_{366N_{72O_{67S \cdot xC_{2H_{4O_{2

  • Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

CAS Number

218949-48-5

Core Areas of Research Investigation

  • Visceral Adiposity & Lipolysis: Investigating mechanisms behind the selective reduction of deep visceral adipose tissue (VAT) and its impact on metabolic health.

  • Metabolic & Lipid Profiles: Examining changes in triglyceride levels, cholesterol fractions, and overall lipid homeostasis in insulin-resistant profiles.

  • Hepatic Fat Accumulation: Assessing the peptide's capacity to reduce intrahepatic lipid content and its implications for nonalcoholic fatty liver disease (NAFLD/MASLD) models.

  • Growth Hormone Axis Dynamics: Evaluating pituitotropic stimulation patterns, growth hormone (GH) secretion pulses, and resulting systemic IGF-1 fluctuations.

  • Cognitive Decline Pathways: Exploring potential protective or restorative influences of GHRH analogues on age-related cognitive functions and mild cognitive impairment (MCI) pathology.

RESEARCH-USE NOTICE

This product is supplied by Biolabs for laboratory and research purposes only. It is not intended to diagnose, treat, cure, or prevent any medical condition and should not be used as a substitute for professional medical advice or treatment.

Any information provided is for general research, product identification, storage, and handling purposes only. The purchaser is responsible for using and storing the product appropriately and in accordance with applicable regulations.

mg

🚚 Nationwide delivery in 3–7 working daysβœ… Free supplement & wellness support with every orderπŸ”’ Secure checkout